Reference Tool
Compare Compounds
Place up to three reference compounds side by side to compare their molecular profile, pharmacokinetics, and handling.
| Attribute | ll-37 | thymosin-alpha-1 | retatrutide |
|---|---|---|---|
| Field of Medicine | Immunology · Antimicrobial Research | Immunology · Host-Defense Research | Endocrinology · Metabolic Research |
| Category | immune | immune | incretin |
| Formula | — | C129H215N33O55 | — |
| Molecular Weight | — | 3108.3 Da | ~4731 Da |
| Sequence | 37-amino-acid cathelicidin ([LL-37, 37 aa]) | 28-amino-acid acetylated peptide | 39-amino-acid triple agonist (GLP-1 / GIP / glucagon) |
| CAS Number | — | 62304-98-7 | — |
| Half-Life | — | ~2 hours systemically | ~6 days |
| Route (research) | — | — | Subcutaneous in research models |
| Onset / Steady-state | — | — | — |
| Lyophilized Storage | −20°C long term; 2–8°C short term (weeks). Protect from light. | −20°C long term; 2–8°C short term (weeks). Protect from light. | −20°C long term; 2–8°C short term (weeks). Protect from light. |
| Reconstituted Storage | 2–8°C, generally up to 14–28 days depending on compound. | 2–8°C, generally up to 14–28 days depending on compound. | 2–8°C, generally up to 14–28 days depending on compound. |